PDB entry 6aam

View 6aam on RCSB PDB site
Description: Crystal structure of TYK2 in complex with peficitinib
Class: transferase/inhibitor
Keywords: protein kinase, TRANSFERASE-INHIBITOR complex
Deposited on 2018-07-18, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-receptor tyrosine-protein kinase TYK2
    Species: Homo sapiens [TaxId:9606]
    Gene: TYK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29597 (3-End)
      • engineered mutation (51)
      • engineered mutation (84)
      • engineered mutation (86-87)
      • engineered mutation (138)
      • engineered mutation (229)
      • engineered mutation (257)
    Domains in SCOPe 2.07: d6aama_
  • Heterogens: 9T6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aamA (A:)
    gpgdptvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkadagpqhrsgw
    kqeidilrtlyhehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfa
    qqicegmaylhaqhyihrnlaarnvlldndrlvkigdfglakavpegheyyrvredgdsp
    vfwyapeclkeykfyyasdvwsfgvtlyellthcdssqspptkfleliglaqgqmtvlrl
    tellergerlprpdkcpaevyhlmkncweteasfrptfenlipilktvhekyqgqaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aamA (A:)
    dptvfhkrylkkirdlggkvslycydptntgemvavkaldagpqhrsgwkqeidilrtly
    hehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfaqqicegmaylh
    aqhyihrnlaarnvlldndrlvkigdfglakavppvfwyapeclkeykfyyasdvwsfgv
    tlyellthcdssqspptkfleliglaqgqmtvlrltellergerlprpdkcpaevyhlmk
    ncweteasfrptfenlipilktvhekyqg