PDB entry 6aaj

View 6aaj on RCSB PDB site
Description: Crystal structure of JAK2 in complex with peficitinib
Class: transferase/inhibitor
Keywords: protein kinase, TRANSFERASE-INHIBITOR complex
Deposited on 2018-07-18, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.3699999999999997 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674
      • engineered mutation (109)
      • engineered mutation (111)
    Domains in SCOPe 2.08: d6aaja_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674
      • engineered mutation (109)
      • engineered mutation (111)
    Domains in SCOPe 2.08: d6aajb_
  • Heterogens: 9T6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aajA (A:)
    gafedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlr
    dfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqahaeridhikl
    lqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkep
    gespifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqm
    ivfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aajA (A:)
    qfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqsteehlrdfereieilk
    slqhdnivkykgvcysnlklimeylpygslrdylqahaeridhikllqytsqickgmeyl
    gtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwyapeslt
    eskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhliellknngr
    lprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aajB (B:)
    gafedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlr
    dfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqahaeridhikl
    lqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkep
    gespifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqm
    ivfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aajB (B:)
    qfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhlrdfereieilkslqh
    dnivkykgvcnlklimeylpygslrdylqahaeridhikllqytsqickgmeylgtkryi
    hrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkgespifwyapeslteskfsvas
    dvwsfgvvlyelftyieksksppaefmrmigndgqmivfhliellknngrlprpdgcpde
    iymimtecwnnnvnqrpsfrdlalrvdqirdnma