PDB entry 6aa7

View 6aa7 on RCSB PDB site
Description: Fluorescent protein from Acropora digitifera
Class: fluorescent protein
Keywords: fluorescent protein, red fluorescent protein, Acropora digitifera, chromophore
Deposited on 2018-07-17, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein
    Species: Acropora digitifera [TaxId:70779]
    Gene: M, LWE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aa7a_
  • Chain 'B':
    Compound: fluorescent protein
    Species: Acropora digitifera [TaxId:70779]
    Gene: M, LWE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aa7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aa7A (A:)
    gshmmalskhgltkdmtmkyrmegcvdghkfvitghgngspfegkqtinlcvveggplpf
    sedilsavfdygnrvftdypqgmvdffknscpagytwqrsllfedgavctasaditvsve
    encfyheskfhgvnfpadgpvmkkmtinwepccekiipvprqgilkgdvamylllkdggr
    yrcqfdtvykaktdskkmpewhfiqhkltredrsdaknqkwqlaehsvasrsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa7A (A:)
    lskhgltkdmtmkyrmegcvdghkfvitghgngspfegkqtinlcvveggplpfsedils
    avfdygnrvftdypqgmvdffknscpagytwqrsllfedgavctasaditvsveencfyh
    eskfhgvnfpadgpvmkkmtinwepccekiipvprqgilkgdvamylllkdggryrcqfd
    tvykaktdskkmpewhfiqhkltredrsdaknqkwqlaehsvasrsala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aa7B (B:)
    gshmmalskhgltkdmtmkyrmegcvdghkfvitghgngspfegkqtinlcvveggplpf
    sedilsavfdygnrvftdypqgmvdffknscpagytwqrsllfedgavctasaditvsve
    encfyheskfhgvnfpadgpvmkkmtinwepccekiipvprqgilkgdvamylllkdggr
    yrcqfdtvykaktdskkmpewhfiqhkltredrsdaknqkwqlaehsvasrsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa7B (B:)
    khgltkdmtmkyrmegcvdghkfvitghgngspfegkqtinlcvveggplpfsedilsav
    fdygnrvftdypqgmvdffknscpagytwqrsllfedgavctasaditvsveencfyhes
    kfhgvnfpadgpvmkkmtinwepccekiipvprqgilkgdvamylllkdggryrcqfdtv
    ykaktdskkmpewhfiqhkltredrsdaknqkwqlaehsvasrsala