PDB entry 6aa3

View 6aa3 on RCSB PDB site
Description: Crystal structure of MTH1 in apo form (cocktail No. 1)
Class: antitumor protein
Keywords: hydrolase, nudt1, antitumor protein
Deposited on 2018-07-17, released 2019-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (1-154)
      • expression tag (155-162)
    Domains in SCOPe 2.08: d6aa3a1, d6aa3a2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aa3A (A:)
    masrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltv
    dalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdds
    ywfplllqkkkfhgyfkfqgqdtildytlrevdtvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa3A (A:)
    asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
    alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
    wfplllqkkkfhgyfkfqgqdtildytlrevdtvlehhhhhh