PDB entry 6aa2

View 6aa2 on RCSB PDB site
Description: X-ray structure of ReQy1 (oxidized form)
Class: fluorescent protein
Keywords: redox status, fluorescent indicator protein, YFP, FLUORESCENT PROTEIN
Deposited on 2018-07-17, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered mutation (29)
      • engineered mutation (49)
      • engineered mutation (67)
      • chromophore (68)
      • engineered mutation (75)
      • engineered mutation (148-149)
      • insertion (150)
      • engineered mutation (154)
      • engineered mutation (157)
      • engineered mutation (167)
      • engineered mutation (179)
      • engineered mutation (207-208)
    Domains in SCOPe 2.07: d6aa2a_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (Start-242)
      • engineered mutation (29)
      • engineered mutation (49)
      • engineered mutation (67)
      • chromophore (68)
      • engineered mutation (75)
      • engineered mutation (148-149)
      • insertion (150)
      • engineered mutation (154)
      • engineered mutation (157)
      • engineered mutation (167)
      • engineered mutation (179)
      • engineered mutation (207-208)
      • engineered mutation (235)
      • expression tag (243)
    Domains in SCOPe 2.07: d6aa2b1, d6aa2b2
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (Start-242)
      • engineered mutation (29)
      • engineered mutation (49)
      • engineered mutation (67)
      • chromophore (68)
      • engineered mutation (75)
      • engineered mutation (148-149)
      • insertion (150)
      • engineered mutation (154)
      • engineered mutation (157)
      • engineered mutation (167)
      • engineered mutation (179)
      • engineered mutation (207-208)
      • engineered mutation (235)
      • expression tag (243)
    Domains in SCOPe 2.07: d6aa2c1, d6aa2c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aa2A (A:)
    mefhvskgeelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvp
    wptlvttlgygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfeg
    dtlvnrielkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedgg
    vqladhyqqntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagitlgmde
    lyklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa2A (A:)
    eelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvpwptlvttl
    gygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
    lkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedggvqladhyq
    qntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aa2B (B:)
    mefhvskgeelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvp
    wptlvttlgygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfeg
    dtlvnrielkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedgg
    vqladhyqqntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagitlgmde
    lyklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa2B (B:)
    eelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvpwptlvttl
    gygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
    lkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedggvqladhyq
    qntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagitlgmdelykl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aa2C (C:)
    mefhvskgeelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvp
    wptlvttlgygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfeg
    dtlvnrielkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedgg
    vqladhyqqntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagitlgmde
    lyklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa2C (C:)
    eelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvpwptlvttl
    gygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
    lkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedggvqladhyq
    qntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagitlgmdelykl