PDB entry 6aa1

View 6aa1 on RCSB PDB site
Description: Crystal structure of putative amino acid binding periplasmic ABC transporter protein from Candidatus Liberibacter asiaticus bound with citrate
Class: transport protein
Keywords: Candidatus Liberibacter asiaticus, periplasmic, ABC transporter, Solute binding, Citrate, TRANSPORT PROTEIN
Deposited on 2018-07-16, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative amino acid-binding periplasmic ABC transporter protein
    Species: Liberibacter asiaticus (strain psy62) [TaxId:537021]
    Gene: CLIBASIA_05070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aa1a_
  • Chain 'B':
    Compound: Putative amino acid-binding periplasmic ABC transporter protein
    Species: Liberibacter asiaticus (strain psy62) [TaxId:537021]
    Gene: CLIBASIA_05070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aa1b_
  • Heterogens: GOL, EDO, CIT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aa1A (A:)
    mfrtedqsalrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsg
    litgldtnrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktva
    qilgtdlsrfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlf
    kiadrmkdnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa1A (A:)
    salrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsglitgldt
    nrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktvaqilgtdl
    srfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlfkiadrmk
    dnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aa1B (B:)
    mfrtedqsalrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsg
    litgldtnrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktva
    qilgtdlsrfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlf
    kiadrmkdnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aa1B (B:)
    salrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsglitgldt
    nrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktvaqilgtdl
    srfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlfkiadrmk
    dnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcss