PDB entry 6a9x

View 6a9x on RCSB PDB site
Description: Crystal Structure of AnkG/GABARAP Complex
Class: protein binding
Keywords: protein binding, structural protein, signaling protein
Deposited on 2018-07-16, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin-3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ank3
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Gabarap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a9xd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a9xD (D:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl