PDB entry 6a9n

View 6a9n on RCSB PDB site
Description: Crystal structure of KAS III from Propionibacterium acnes
Class: transferase
Keywords: ketoacyl-ACP synthase, TRANSFERASE
Deposited on 2018-07-14, released 2019-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Cutibacterium acnes [TaxId:1747]
    Gene: fabH, B1B09_02220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2B7IGT3 (Start-332)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d6a9na1, d6a9na2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Cutibacterium acnes [TaxId:1747]
    Gene: fabH, B1B09_02220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2B7IGT3 (Start-332)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d6a9nb1, d6a9nb2
  • Heterogens: K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a9nA (A:)
    hmtaiktrpvhgyskflstgsargsrvvtnkemctlidstpewieqrtgiterrwatnse
    tvasmgttaartalersgleasqidaiivatvshhrpspslaayiarelglgdaaafdln
    gaaagfcystaladsmirtgsanyvlvigveklsemtnlddrstaflfsdgagaaiigas
    depgigpvvwgsrsdqlktieledwptasadpnkihplirmegravfkwamtdvakraae
    aiaeagitpadldvfiphqandritdvvsrhlklpesvtvchdiadmgntsaasvpiaid
    rmlqrgqahsgdlaliigfgaglvyagqvirlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a9nA (A:)
    taiktrpvhgyskflstgsargsrvvtnkemctlidstpewieqrtgiterrwatnsetv
    asmgttaartalersgleasqidaiivatvshhrpspslaayiarelglgdaaafdlnga
    aagfcystaladsmirtgsanyvlvigveklsemtnlddrstaflfsdgagaaiigasde
    pgigpvvwgsrsdqlktieledwptasadpnkihplirmegravfkwamtdvakraaeai
    aeagitpadldvfiphqandritdvvsrhlklpesvtvchdiadmgntsaasvpiaidrm
    lqrgqahsgdlaliigfgaglvyagqvirlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a9nB (B:)
    hmtaiktrpvhgyskflstgsargsrvvtnkemctlidstpewieqrtgiterrwatnse
    tvasmgttaartalersgleasqidaiivatvshhrpspslaayiarelglgdaaafdln
    gaaagfcystaladsmirtgsanyvlvigveklsemtnlddrstaflfsdgagaaiigas
    depgigpvvwgsrsdqlktieledwptasadpnkihplirmegravfkwamtdvakraae
    aiaeagitpadldvfiphqandritdvvsrhlklpesvtvchdiadmgntsaasvpiaid
    rmlqrgqahsgdlaliigfgaglvyagqvirlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a9nB (B:)
    taiktrpvhgyskflstgsargsrvvtnkemctlidstpewieqrtgiterrwatnsetv
    asmgttaartalersgleasqidaiivatvshhrpspslaayiarelglgdaaafdlnga
    aagfcystaladsmirtgsanyvlvigveklsemtnlddrstaflfsdgagaaiigasde
    pgigpvvwgsrsdqlktieledwptasadpnkihplirmegravfkwamtdvakraaeai
    aeagitpadldvfiphqandritdvvsrhlklpesvtvchdiadmgntsaasvpiaidrm
    lqrgqahsgdlaliigfgaglvyagqvirlp