PDB entry 6a9k

View 6a9k on RCSB PDB site
Description: Crystal structure of the complex of the hydrolytic antibody Fab 9C10 with a transition-state analog
Class: immune system
Keywords: Catalytic Antibody, Hydrolytic Antibody, 9C10, Fab, Complex, Transition-State Analog, IMMUNE SYSTEM
Deposited on 2018-07-13, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin 9c10 l chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A9K (0-218)
    Domains in SCOPe 2.07: d6a9ka1, d6a9ka2
  • Chain 'B':
    Compound: immunoglobulin 9c10 h chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A9K (0-219)
  • Chain 'H':
    Compound: immunoglobulin 9c10 h chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A9K (0-219)
  • Chain 'L':
    Compound: immunoglobulin 9c10 l chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A9K (0-218)
    Domains in SCOPe 2.07: d6a9kl1, d6a9kl2
  • Heterogens: 9T0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a9kA (A:)
    dllmaqtplslpvslgdqasiscrssqslvhssgntylewylqkpgqspklliykisnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqtshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a9kL (L:)
    dllmaqtplslpvslgdqasiscrssqslvhssgntylewylqkpgqspklliykisnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqtshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec