PDB entry 6a9d

View 6a9d on RCSB PDB site
Description: Crystal structure of the strigolactone receptor ShHTL7 from Striga hermonthica
Class: plant protein
Keywords: Receptor, Strigolactones, Protein, Inhibitor, PLANT PROTEIN
Deposited on 2018-07-13, released 2019-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyposensitive to light 7
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3PNA2 (14-End)
      • expression tag (7-13)
    Domains in SCOPe 2.07: d6a9da1, d6a9da2
  • Chain 'B':
    Compound: Hyposensitive to light 7
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a9db_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a9dA (A:)
    masmtggqqmgrdpmssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykv
    llydhmgagttnpdyfdfdrysslegysydliaileefqvskciyvghsmssmaaavasi
    frpdlfhklvmisptprlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdl
    esaamqeycrtlfnmrpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavge
    ylrknlggpsvvevmpteghlphlsmpevtipvvlrhirqditdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a9dA (A:)
    qqmgrdpmssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmg
    agttnpdyfdfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfh
    klvmisptprlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqe
    ycrtlfnmrpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlg
    gpsvvevmpteghlphlsmpevtipvvlrhirqdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a9dB (B:)
    masmtggqqmgrdpmssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykv
    llydhmgagttnpdyfdfdrysslegysydliaileefqvskciyvghsmssmaaavasi
    frpdlfhklvmisptprlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdl
    esaamqeycrtlfnmrpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavge
    ylrknlggpsvvevmpteghlphlsmpevtipvvlrhirqditdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a9dB (B:)
    siglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgagttnpdyf
    dfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhklvmisptp
    rlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeycrtlfnmr
    pdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggpsvvevmp
    teghlphlsmpevtipvvlrhirqdi