PDB entry 6a9b

View 6a9b on RCSB PDB site
Description: T4 dCMP hydroxymethylase structure solved by I-SAD using a home source
Class: transferase
Keywords: pyrimidine hydroxymethylase, TRANSFERASE
Deposited on 2018-07-12, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deoxycytidylate 5-hydroxymethyltransferase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a9ba_
  • Heterogens: IOD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a9bA (A:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    yvgkya