PDB entry 6a8t

View 6a8t on RCSB PDB site
Description: E269A mutant of highly active EfBSH
Class: hydrolase
Keywords: Ntn, Bile Salt Hydrolase, Gut Microbiome, HYDROLASE
Deposited on 2018-07-10, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d6a8ta_
  • Chain 'B':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d6a8tb_
  • Chain 'C':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d6a8tc_
  • Chain 'D':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d6a8td_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8tA (A:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8tA (A:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8tB (B:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8tB (B:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a8tC (C:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8tC (C:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6a8tD (D:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8tD (D:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan