PDB entry 6a8s

View 6a8s on RCSB PDB site
Description: Crystal Structure of the putative amino acid-binding periplasmic ABC transporter protein from Candidatus Liberibacter asiaticus in complex with Cysteine
Class: transport protein
Keywords: Candidatus Liberibacter asiaticus, Periplasmic, Solute Binding, Cysteine, TRANSPORT PROTEIN
Deposited on 2018-07-10, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative amino acid-binding periplasmic ABC transporter protein
    Species: Liberibacter asiaticus (strain psy62) [TaxId:537021]
    Gene: CLIBASIA_05070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a8sa_
  • Chain 'B':
    Compound: Putative amino acid-binding periplasmic ABC transporter protein
    Species: Liberibacter asiaticus (strain psy62) [TaxId:537021]
    Gene: CLIBASIA_05070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a8sb_
  • Heterogens: SO4, EDO, TRS, ACT, GOL, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8sA (A:)
    mfrtedqsalrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsg
    litgldtnrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktva
    qilgtdlsrfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlf
    kiadrmkdnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8sA (A:)
    salrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsglitgldt
    nrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktvaqilgtdl
    srfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlfkiadrmk
    dnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8sB (B:)
    mfrtedqsalrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsg
    litgldtnrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktva
    qilgtdlsrfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlf
    kiadrmkdnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8sB (B:)
    salrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsglitgldt
    nrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktvaqilgtdl
    srfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlfkiadrmk
    dnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcss