PDB entry 6a8q

View 6a8q on RCSB PDB site
Description: R207A mutant of highly active EfBSH
Class: hydrolase
Keywords: Ntn, Bile Salt Hydrolase, Gut Microbiome, HYDROLASE
Deposited on 2018-07-10, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d6a8qa_
  • Chain 'B':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d6a8qb_
  • Chain 'C':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d6a8qc_
  • Chain 'D':
    Compound: Bile salt hydrolase
    Species: Enterococcus faecalis T2 [TaxId:565637]
    Gene: EFBG_01849
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7CXJ5 (0-322)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d6a8qd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8qA (A:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8qA (A:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8qB (B:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8qB (B:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a8qC (C:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8qC (C:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6a8qD (D:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8qD (D:)
    ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysagmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan