PDB entry 6a8o

View 6a8o on RCSB PDB site
Description: Crystal structures of the serine protease domain of murine plasma kallikrein with peptide inhibitor mupain-1-16
Class: hydrolase
Keywords: serine protease, murine plasma kallikrein, HYDROLASE
Deposited on 2018-07-09, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasma kallikrein
    Species: Mus musculus [TaxId:10090]
    Gene: Klkb1, Klk3, Pk
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26262 (0-End)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d6a8oa_
  • Chain 'B':
    Compound: Plasma kallikrein
    Species: Mus musculus [TaxId:10090]
    Gene: Klkb1, Klk3, Pk
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26262 (0-End)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d6a8ob_
  • Chain 'P':
    Compound: peptide inhibitor,
    Species: Synthemiopsis [TaxId:448014]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A8O (0-5)
    • PDB 6A8O (6-9)
  • Heterogens: MAN, MRZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8oA (A:)
    ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
    ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
    ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
    tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektqssdv
    raletssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8oA (A:)
    ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
    ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
    ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
    tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8oB (B:)
    ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
    ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
    ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
    tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektqssdv
    raletssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8oB (B:)
    ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
    ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
    ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
    tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq
    

  • Chain 'P':
    No sequence available.