PDB entry 6a8l

View 6a8l on RCSB PDB site
Description: Crystal structure of nicotinamidase/ pyrazinamidase PncA from Bacillus subtilis
Class: metal binding protein
Keywords: Bacillus subtilis, nicotinamidase/pyrazinamidase, HYDROLASE, METAL BINDING PROTEIN
Deposited on 2018-07-09, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isochorismatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BMJ37_14840
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D3DSA4 (0-182)
      • engineered mutation (4)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6a8la_
  • Chain 'B':
    Compound: Isochorismatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BMJ37_14840
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D3DSA4 (0-182)
      • engineered mutation (4)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6a8lb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a8lA (A:)
    mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdaddd
    fhpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklre
    rqiaelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaq
    vae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a8lB (B:)
    mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdaddd
    fhpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklre
    rqiaelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaq
    vae