PDB entry 6a8i

View 6a8i on RCSB PDB site
Description: Crystal structure of endo-arabinanase ABN-TS D147N mutant in complex with arabinohexaose
Class: hydrolase
Keywords: arabinanase, thermostable enzyme, glycoside hydrolase, gh43, HYDROLASE
Deposited on 2018-07-09, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Gene: abn-ts
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93HT9 (Start-312)
      • engineered mutation (146)
      • expression tag (313-318)
    Domains in SCOPe 2.07: d6a8ia1, d6a8ia2
  • Chain 'B':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Gene: abn-ts
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93HT9 (Start-312)
      • engineered mutation (146)
      • expression tag (313-318)
    Domains in SCOPe 2.07: d6a8ib1, d6a8ib2
  • Heterogens: CA, AHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8iA (A:)
    mvhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenm
    grvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtld
    prdpdyewkdmgpvihstasdnynainpnvvfdqegqpwlsfgsfwsgiqliqldtetmk
    paaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskdit
    gpyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqi
    rplywddegwpyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8iA (A:)
    vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
    rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
    rdpdyewkdmgpvihstasdnynainpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpyllehhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8iB (B:)
    mvhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenm
    grvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtld
    prdpdyewkdmgpvihstasdnynainpnvvfdqegqpwlsfgsfwsgiqliqldtetmk
    paaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskdit
    gpyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqi
    rplywddegwpyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8iB (B:)
    vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
    rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
    rdpdyewkdmgpvihstasdnynainpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpyllehhhh