PDB entry 6a8c

View 6a8c on RCSB PDB site
Description: Ribokinase from Leishmania donovani with ADP
Class: transferase
Keywords: Nucleotide binding, ATP binding, Metal ion binding, Ribokinase activity, Carbohydrate metabolic process, cytoplasm, TRANSFERASE
Deposited on 2018-07-06, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribokinase
    Species: Leishmania donovani BPK282A1 [TaxId:981087]
    Gene: LDBPK_270430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a8ca_
  • Chain 'B':
    Compound: ribokinase
    Species: Leishmania donovani BPK282A1 [TaxId:981087]
    Gene: LDBPK_270430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a8cb_
  • Heterogens: GOL, NA, CL, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8cA (A:)
    mgsshhhhhhssglvprgshmhrarnvrshtgeyapdilvvgscfldyvgyvdhmpqvge
    tmhsvsfhkgfggkganqavaagrlgakvamvsmvgtdgdgsdyikelerngvdtaymfr
    tgksstglamilvdtkssnneivicpnatnhftpellraqtnnyerilhtglkylicqne
    iplpttldtikeahsrgvytvfnsapapkpaeveqikpflpyvslfcpneveatlitgvk
    vtdtesafsaikalqqlgvrdvvitlgaagfvlsengaepvhvtgkhvkavdttgagdcf
    vgsmvyfmsrgrnlleackranecaaisvtrkgtqlsyphpselpagvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8cA (A:)
    rarnvrshtgeyapdilvvgscfldyvgyvdhmpqvgetmhsvsfhkgfggkganqavaa
    grlgakvamvsmvgtdgdgsdyikelerngvdtaymfrtgksstglamilvdtkssnnei
    vicpnatnhftpellraqtnnyerilhtglkylicqneiplpttldtikeahsrgvytvf
    nsapapkpaeveqikpflpyvslfcpneveatlitgvkvtdtesafsaikalqqlgvrdv
    vitlgaagfvlsengaepvhvtgkhvkavdttgagdcfvgsmvyfmsrgrnlleackran
    ecaaisvtrkgtqlsyphpselpagvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8cB (B:)
    mgsshhhhhhssglvprgshmhrarnvrshtgeyapdilvvgscfldyvgyvdhmpqvge
    tmhsvsfhkgfggkganqavaagrlgakvamvsmvgtdgdgsdyikelerngvdtaymfr
    tgksstglamilvdtkssnneivicpnatnhftpellraqtnnyerilhtglkylicqne
    iplpttldtikeahsrgvytvfnsapapkpaeveqikpflpyvslfcpneveatlitgvk
    vtdtesafsaikalqqlgvrdvvitlgaagfvlsengaepvhvtgkhvkavdttgagdcf
    vgsmvyfmsrgrnlleackranecaaisvtrkgtqlsyphpselpagvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8cB (B:)
    rarnvrshtgeyapdilvvgscfldyvgyvdhmpqvgetmhsvsfhkgfggkganqavaa
    grlgakvamvsmvgtdgdgsdyikelerngvdtaymfrtgksstglamilvdtkssnnei
    vicpnatnhftpellraqtnnyerilhtglkylicqneiplpttldtikeahsrgvytvf
    nsapapkpaeveqikpflpyvslfcpneveatlitgvkvtdtesafsaikalqqlgvrdv
    vitlgaagfvlsengaepvhvtgkhvkavdttgagdcfvgsmvyfmsrgrnlleackran
    ecaaisvtrkgtqlsyphpselpagvm