PDB entry 6a89

View 6a89 on RCSB PDB site
Description: Crystal structure of the ternary complex of peptidoglycan recognition protein (PGRP-S) with Tartaric acid, Ribose and 2,6-DIAMINOPIMELIC ACID at 2.11 A resolution
Class: immune system
Keywords: immune system
Deposited on 2018-07-06, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a89a_
  • Chain 'B':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a89b_
  • Chain 'C':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a89c_
  • Chain 'D':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a89d_
  • Heterogens: EDO, API, GOL, TLA, RIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a89A (A:)
    acgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnl
    gwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraa
    qnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a89B (B:)
    acgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnl
    gwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraa
    qnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a89C (C:)
    acgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnl
    gwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraa
    qnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a89D (D:)
    acgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnl
    gwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraa
    qnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra