PDB entry 6a7u

View 6a7u on RCSB PDB site
Description: Crystal structure of histone H2A.Bbd-H2B dimer
Class: DNA binding protein
Keywords: Histone, Histone variant, H2A.Bbd, DNA BINDING PROTEIN
Deposited on 2018-07-04, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H2B type 2-E,Histone H2A-Bbd type 2/3
    Species: Homo sapiens [TaxId:9606]
    Gene: H2AFB2, H2AFB3, H2ABBD, H2AFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a7ua1, d6a7ua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a7uA (A:)
    mpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsskprrrrrrgssgaggrgrtcsrtvraelsfsvsqverslreghyaqrlsrtapvy
    laavieyltakvlelagneaqnsgernitpllldmvvhndrllstlfntttisqvapged
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7uA (A:)
    sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkytsssrtvraelsfsvsqverslreghyaqrlsrt
    apvylaavieyltakvlelagneaqnsgernitpllldmvvhndrllstl