PDB entry 6a7t

View 6a7t on RCSB PDB site
Description: Ca2+-independent C-type lectin SPL-1 from Saxidomus purpuratus
Class: sugar binding protein
Keywords: SPL-1, lectin, bivalve, Saxidomus purpuratus, C-type, SUGAR BINDING PROTEIN
Deposited on 2018-07-04, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-specific lectin
    Species: Saxidomus purpuratus [TaxId:311201]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a7ta_
  • Chain 'B':
    Compound: N-acetylglucosamine-specific lectin
    Species: Saxidomus purpuratus [TaxId:311201]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a7tb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a7tA (A:)
    mlngpsiiislffcfvsgayacckcdcqsgwewfggscylfdetergwedsktfcesqna
    alvtvesseeddfirgvisaqsafhyywiggswdaehseyrwidgssisfngwgpnrpda
    degcmdylnykeivwqwndhqdcvntkgpsicetdcse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7tA (A:)
    cckcdcqsgwewfggscylfdetergwedsktfcesqnaalvtvesseeddfirgvisaq
    safhyywiggswdaehseyrwidgssisfngwgpnrpdadegcmdylnykeivwqwndhq
    dcvntkgpsicetdcse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a7tB (B:)
    mlngasiivslflcfvggayaccseddcpsgwkffggscylfdegsrgwegskafceskd
    aslvtvecskeddfirgilsgqtakhyywigarwneehndyrwidgspftfigwgpgkpd
    nnkgcldylnykevvwqwndhvdcentngpciceidcsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7tB (B:)
    ccseddcpsgwkffggscylfdegsrgwegskafceskdaslvtvecskeddfirgilsg
    qtakhyywigarwneehndyrwidgspftfigwgpgkpdnnkgcldylnykevvwqwndh
    vdcentngpciceidcsd