PDB entry 6a7j

View 6a7j on RCSB PDB site
Description: Testerone bound CYP154C4 from Streptomyces sp. ATCC 11861
Class: oxidoreductase
Keywords: cytochrome P450, Streptomyces, steroid hydroxylase, OXIDOREDUCTASE
Deposited on 2018-07-03, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Streptomyces violaceoruber [TaxId:1935]
    Gene: B1H20_20375
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a7ja1, d6a7ja2
  • Heterogens: HEM, TES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a7jA (A:)
    rlmtrialdpfvrdldgesaalraagplaevelpggvhvyavthhkearalltdsrvvkd
    invwnawqrgeipadwpliglvnpgrsmltvdgpdhrrlrtlvaqaltvkrveklragie
    altnaslerlaalpagepvdlkaefayplpmnviselmgvdaadhprlkelfekffstqt
    ppeevpqmmadlgtlftkiveekkanpgddltsaliaasedgdhltdeeilntlqliiaa
    ghettislivnvvealaihpeqrkkvlsgeipwegvieetlrwntptshvlirfatedie
    vgdkvlpkgeglvvsfgalgrdeeqygptagdfdatrtpnrhiafghgphvcpgaalsrl
    eagialpalyerfpeldlavpaaelrnkpivtqndlhdlpvklgcpfghda
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7jA (A:)
    lmtrialdpfvrdldgesaalraagplaevelpggvhvyavthhkearalltdsrvvkdi
    nvwnawqrgeipadwpliglvnpgrsmltvdgpdhrrlrtlvaqaltvkrveklragiea
    ltnaslerlaalpagepvdlkaefayplpmnviselmgvdaadhprlkelfekffstqtp
    peevpqmmadlgtlftkiveekkanpgddltsaliaasedgdhltdeeilntlqliiaag
    hettislivnvvealaihpeqrkkvlsgeipwegvieetlrwntptshvlirfatediev
    gdkvlpkgeglvvsfgalgrdeeqygptagdfdatrtpnrhiafghgphvcpgaalsrle
    agialpalyerfpeldlavpaaelrnkpivtqndlhdlpvklgcpfg