PDB entry 6a7b

View 6a7b on RCSB PDB site
Description: AKR1C3 complexed with new inhibitor with novel scaffold
Class: oxidoreductase
Keywords: Aldo-keto reductase family 1 member C3, type 5 17-beta-hydroxysteroid dehydrogenase, prostaglandin F synthase, OXIDOREDUCTASE
Deposited on 2018-07-02, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C3
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a7ba_
  • Chain 'B':
    Compound: Aldo-keto reductase family 1 member C3
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a7bb_
  • Heterogens: NAP, 9S0, DMF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a7bA (A:)
    mdskhqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7bA (A:)
    qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
    rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
    eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
    pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
    kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
    fnsdsfashpnypysdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a7bB (B:)
    mdskhqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7bB (B:)
    qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
    rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpi
    fdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkykpvcnqvechpyfn
    rsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcalakkhkrtpalialr
    yqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhyfnsdsfashpnyp
    ys