PDB entry 6a79

View 6a79 on RCSB PDB site
Description: Crystal structure of the fifth immunoglobulin domain (Ig5) of human Robo1 in complex with the mutant scFv fragment (P103A) of murine monoclonal antibody B5209B
Class: immune system
Keywords: hepatocellular carcinoma antigen, angiogenesis, immune system, antibody drug, single-chain variable fragment
Deposited on 2018-07-02, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.3099999999999996 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROBO1, DUTT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6N7 (2-90)
      • expression tag (1)
    Domains in SCOPe 2.08: d6a79a1, d6a79a2
  • Chain 'B':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROBO1, DUTT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6N7 (2-90)
      • expression tag (1)
    Domains in SCOPe 2.08: d6a79b1, d6a79b2
  • Chain 'H':
    Compound: Heavy chain of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A79 (0-End)
    Domains in SCOPe 2.08: d6a79h_
  • Chain 'I':
    Compound: Heavy chain of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A79 (0-End)
    Domains in SCOPe 2.08: d6a79i_
  • Chain 'L':
    Compound: Light chain region of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A79
    Domains in SCOPe 2.08: d6a79l_
  • Chain 'M':
    Compound: Light chain region of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A79
    Domains in SCOPe 2.08: d6a79m_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a79A (A:)
    mgpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqi
    ryaklgdtgrytciastpsgeatwsayievq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a79A (A:)
    gpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqir
    yaklgdtgrytciastpsgeatwsayievq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a79B (B:)
    mgpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqi
    ryaklgdtgrytciastpsgeatwsayievq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a79B (B:)
    gpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqir
    yaklgdtgrytciastpsgeatwsayievq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6a79H (H:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrpayyaldywgqgtsvtv
    ssaggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a79H (H:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrpayyaldywgqgtsvtv
    ss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6a79I (I:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrpayyaldywgqgtsvtv
    ssaggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a79I (I:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrpayyaldywgqgtsvtv
    ss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6a79L (L:)
    dildiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladd
    kssrfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleikaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a79L (L:)
    ldiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladdks
    srfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleik
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6a79M (M:)
    dildiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladd
    kssrfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleikaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a79M (M:)
    ildiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladdk
    ssrfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleik