PDB entry 6a77

View 6a77 on RCSB PDB site
Description: Crystal structure of the fifth immunoglobulin domain (Ig5) of human Robo1 in complex with the Fab fragment of murine monoclonal antibody B5209B
Class: immune system
Keywords: hepatocellular carcinoma antigen, angiogenesis, immune system, antibody drug
Deposited on 2018-07-02, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROBO1, DUTT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6N7 (2-90)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6a77a1, d6a77a2
  • Chain 'H':
    Compound: Heavy chain of the anti-human Robo1 antibody B5209B Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A77 (0-220)
  • Chain 'L':
    Compound: Light chain of the anti-human Robo1 antibody B5209B Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A77 (0-210)
    Domains in SCOPe 2.07: d6a77l1, d6a77l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a77A (A:)
    mgpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqi
    ryaklgdtgrytciastpsgeatwsayievq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a77L (L:)
    diqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladdkss
    rfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr