PDB entry 6a72

View 6a72 on RCSB PDB site
Description: Copper transporter protein
Class: metal transport
Keywords: Copper transporter protein, METAL TRANSPORT
Deposited on 2018-07-01, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP7B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a72a_
  • Chain 'B':
    Compound: ATP7B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a72b_
  • Heterogens: 9UX, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a72A (A:)
    tcsttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraa
    iedmgfeasvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a72A (A:)
    csttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraai
    edmgfeasvvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a72B (B:)
    tcsttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraa
    iedmgfeasvvs