PDB entry 6a71

View 6a71 on RCSB PDB site
Description: Crystal Structure of Human ATP7B and TM Complex
Class: metal transport
Keywords: Copper transporter protein, METAL TRANSPORT
Deposited on 2018-06-30, released 2019-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP7B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a71a_
  • Chain 'B':
    Compound: ATP7B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a71b_
  • Heterogens: PEG, GOL, CA, 9UX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6a71A (A:)
tcsttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraa
iedmgfeasvvs

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6a71B (B:)
tcsttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraa
iedmgfeasvvs

    Sequence, based on observed residues (ATOM records): (download) 
    >6a71B (B:)
csttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraai
edmgfeasvvs