PDB entry 6a6y

View 6a6y on RCSB PDB site
Description: Crystal Structure of Asf1 from Plasmodium falciparum
Class: chaperone
Keywords: Histone chaperone, Chromatin assembly and disassembly, Plasmodium facliparum, CHAPERONE
Deposited on 2018-06-29, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone chaperone ASF1, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF3D7_1224500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6ya_
  • Chain 'B':
    Compound: Histone chaperone ASF1, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF3D7_1224500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6yb_
  • Heterogens: SCN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6yA (A:)
    gpmsevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavnnegesnqdi
    eldniflgpiergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymns
    fykdmelrenppvvpqydkicrhifvenprivkfsigwdse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6yA (A:)
    msevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavnqdieldniflg
    piergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymnsfykdmelr
    enppvvpqydkicrhifvenprivkfsigwds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a6yB (B:)
    gpmsevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavnnegesnqdi
    eldniflgpiergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymns
    fykdmelrenppvvpqydkicrhifvenprivkfsigwdse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6yB (B:)
    msevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavqdieldniflgp
    iergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymnsfykdmelre
    nppvvpqydkicrhifvenprivkfsigwds