PDB entry 6a6q

View 6a6q on RCSB PDB site
Description: Crystal strcuture of a lignin peroxidase isozyme H8 variant that is stable at very acidic pH
Class: oxidoreductase
Keywords: peroxidase, OXIDOREDUCTASE, heme binding domain
Deposited on 2018-06-29, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ligninase H8
    Species: Phanerochaete chrysosporium RP-78 [TaxId:273507]
    Gene: LPOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06181
      • engineered mutation (61)
      • engineered mutation (162)
      • engineered mutation (245)
    Domains in SCOPe 2.07: d6a6qa_
  • Heterogens: HEB, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6qA (A:)
    aaviekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiais
    prmeaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafag
    rvalsncpgapqmnfftgrapatqpapdglvpepfhtvdqiiervndagefdelelvwml
    sahsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgei
    riqsdetiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqsk
    pipgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6qA (A:)
    kratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaisprmea
    qgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagrvals
    ncpgapqmnfftgrapatqpapdglvpepfhtvdqiiervndagefdelelvwmlsahsv
    aavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsd
    etiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgn
    lpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppg