PDB entry 6a6p

View 6a6p on RCSB PDB site
Description: Crystal Structure of Peroxisome Proliferator-Activated Receptor Delta (PPARd)LBD in Complex with DN003316
Class: structural protein
Keywords: PPARdelta, complex, nuclear receptor, peroxisome proliferator-activated receptor family, ligand binding domain (LBD), STRUCTURAL PROTEIN
Deposited on 2018-06-29, released 2019-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a6pa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a6pb_
  • Heterogens: 9RF, B7G, PE3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6pA (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6pA (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a6pB (B:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6pB (B:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkn
    glppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifam
    lasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfia
    aiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteh
    aqmmqrikktetetslhpllqeiykdm