PDB entry 6a6l

View 6a6l on RCSB PDB site
Description: Crystal structure of the cold shock domain of YB-1 in complex with m5C RNA
Class: RNA binding protein/RNA
Keywords: CSD domain, CAUC motif, RNA BINDING PROTEIN-RNA complex
Deposited on 2018-06-28, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease-sensitive element-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: YB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6la_
  • Chain 'D':
    Compound: RNA (5'-r(p*cp*ap*up*(5mc))-3')
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: 5MC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6lA (A:)
    gsgdkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnprkylrsvgdge
    tvefdvvegekgaeaanvtgpgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6lA (A:)
    kkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnpylrsvgdgetvefdv
    vegekgaeaanvtgpg
    

  • Chain 'D':
    No sequence available.