PDB entry 6a6k

View 6a6k on RCSB PDB site
Description: Crystal structure of Estrogen-related Receptor-3 (ERR-gamma) ligand binding domain with DN201000
Class: transcription
Keywords: Sodium iodide symporter (NIS), Anaplastic thyroid cancer, Estrogen-related receptor gamma, Radioiodine therapy, TRANSCRIPTION
Deposited on 2018-06-28, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG, ERR3, ERRG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6ka_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG, ERR3, ERRG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6kb_
  • Chain 'C':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG, ERR3, ERRG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6kc_
  • Heterogens: 9S6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6kA (A:)
    mlnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvvii
    gwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqskla
    glldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealq
    dyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6kA (A:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a6kB (B:)
    mlnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvvii
    gwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqskla
    glldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealq
    dyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6kB (B:)
    ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
    ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
    kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
    agkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a6kC (C:)
    mlnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvvii
    gwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqskla
    glldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealq
    dyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6kC (C:)
    kivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsla
    dqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvkk
    yksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprrag
    kmlmtlpllrqtstkavqhfyn