PDB entry 6a6f

View 6a6f on RCSB PDB site
Description: Crystal structure of Putative iron-sulfur cluster assembly scaffold protein for SUF system (FiSufU) from thermophilic Fervidobacterium Islandicum AW-1
Class: biosynthetic protein
Keywords: SufE, Thermophile, Fe-S cluster scaffold protein, BIOSYNTHETIC PROTEIN
Deposited on 2018-06-27, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-sulfur cluster assembly scaffold protein NifU
    Species: Fervidobacterium islandicum [TaxId:2423]
    Gene: NA23_08310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6fa1, d6a6fa2
  • Chain 'B':
    Compound: Iron-sulfur cluster assembly scaffold protein NifU
    Species: Fervidobacterium islandicum [TaxId:2423]
    Gene: NA23_08310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6fb1, d6a6fb2
  • Heterogens: GOL, PEG, ZN, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6fA (A:)
    gshmiysefimdysklkkfhgkienahkveegknlscgdevtlyflfdgdkivdvkfegh
    gcaisqastnvmieqiigktkqealemmknaenmmlgkefdenvlgpiinfydvknypmr
    vkcfllpwktleialkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6fA (A:)
    gshmiysefimdysklkkfhgkienahkveegknlscgdevtlyflfdgdkivdvkfegh
    gcaisqastnvmieqiigktkqealemmknaenmmlgkefdenvlgpiinfydvknypmr
    vkcfllpwktleialk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a6fB (B:)
    gshmiysefimdysklkkfhgkienahkveegknlscgdevtlyflfdgdkivdvkfegh
    gcaisqastnvmieqiigktkqealemmknaenmmlgkefdenvlgpiinfydvknypmr
    vkcfllpwktleialkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6fB (B:)
    gshmiysefimdysklkkfhgkienahkveegknlscgdevtlyflfdgdkivdvkfegh
    gcaisqastnvmieqiigktkqealemmknaenmmlgkefdenvlgpiinfydvknypmr
    vkcfllpwktleialk