PDB entry 6a6e

View 6a6e on RCSB PDB site
Description: Crystal structure of thermostable Cysteine desulfurase (FiSufS) from thermophilic Fervidobacterium Islandicum AW-1
Class: transferase
Keywords: Cysteine desulfurase, Thermophile, Suf gene cluster, TRANSFERASE
Deposited on 2018-06-27, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Fervidobacterium islandicum [TaxId:2423]
    Gene: NA23_08315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6ea1, d6a6ea2
  • Chain 'B':
    Compound: Cysteine desulfurase
    Species: Fervidobacterium islandicum [TaxId:2423]
    Gene: NA23_08315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6eb1, d6a6eb2
  • Chain 'C':
    Compound: Cysteine desulfurase
    Species: Fervidobacterium islandicum [TaxId:2423]
    Gene: NA23_08315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6ec1, d6a6ec2
  • Chain 'D':
    Compound: Cysteine desulfurase
    Species: Fervidobacterium islandicum [TaxId:2423]
    Gene: NA23_08315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a6ed1, d6a6ed2
  • Heterogens: PLP, GOL, CIT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a6eA (A:)
    ssghmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyh
    ysnihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgil
    ktedtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvv
    sitgqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgp
    tgigvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgyti
    dylesigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvsh
    ildenfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyi
    rrwfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6eA (A:)
    hmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysn
    ihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkte
    dtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsit
    gqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgi
    gvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyl
    esigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshild
    enfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrw
    fe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a6eB (B:)
    ssghmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyh
    ysnihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgil
    ktedtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvv
    sitgqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgp
    tgigvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgyti
    dylesigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvsh
    ildenfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyi
    rrwfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6eB (B:)
    hmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysn
    ihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkte
    dtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsit
    gqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgi
    gvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyl
    esigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshild
    enfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrw
    fe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a6eC (C:)
    ssghmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyh
    ysnihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgil
    ktedtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvv
    sitgqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgp
    tgigvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgyti
    dylesigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvsh
    ildenfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyi
    rrwfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6eC (C:)
    hmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysn
    ihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkte
    dtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsit
    gqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgi
    gvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyl
    esigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshild
    enfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrw
    fe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6a6eD (D:)
    ssghmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyh
    ysnihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgil
    ktedtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvv
    sitgqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgp
    tgigvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgyti
    dylesigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvsh
    ildenfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyi
    rrwfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a6eD (D:)
    hmrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysn
    ihravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkte
    dtvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsit
    gqsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgi
    gvlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyl
    esigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshild
    enfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrw
    fe