PDB entry 6a66

View 6a66 on RCSB PDB site
Description: Placental protein 13/galectin-13 variant R53H with Tris
Class: sugar binding protein
Keywords: Sugar binding protein
Deposited on 2018-06-26, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding soluble lectin 13
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHV8 (4-141)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d6a66a_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a66A (A:)
    gshmsslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvh
    fgnhvvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrip
    psfvkmvqvsrdisltsvcvcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a66A (A:)
    sslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvhfgnh
    vvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsfv
    kmvqvsrdisltsvcvcn