PDB entry 6a62

View 6a62 on RCSB PDB site
Description: Placental protein 13/galectin-13 variant R53HH57RD33G with Lactose
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2018-06-26, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding soluble lectin 13
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS13, PLAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHV8 (0-137)
      • engineered mutation (31)
      • engineered mutation (51)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d6a62a_
  • Heterogens: LAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6a62A (A:)
sslpvpyklpvslsvgscviikgtpihsfingpqlqvdfytdmdedsdiafhfrvrfgnh
vvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsfv
kmvqvsrdisltsvcvcn