PDB entry 6a5i

View 6a5i on RCSB PDB site
Description: Pseudocerastes Persicus Trypsin Inhibitor
Class: toxin
Keywords: Kunitz-type protein, Dendrotoxin, Serine protease inhibitor, TOXIN
Deposited on 2018-06-23, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor
    Species: Pseudocerastes persicus [TaxId:47769]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A5I (0-67)
    Domains in SCOPe 2.07: d6a5ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a5iA (A:)
    edrpkfcylpddpgvckahiprfyynpasnkckefiyggcggnannfetraecrhtcvas
    rkggprrp