PDB entry 6a4u

View 6a4u on RCSB PDB site
Description: The first crystal structure of crustacean ferritin that is a hybrid type of H and L ferritin
Class: metal binding protein
Keywords: ferritin, crustacean, iron, ferroxidase site, nucleation site, METAL BINDING PROTEIN
Deposited on 2018-06-21, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Marsupenaeus japonicus [TaxId:27405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B7E1 (0-168)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6a4ua_
  • Chain 'B':
    Compound: Ferritin
    Species: Marsupenaeus japonicus [TaxId:27405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B7E1 (0-168)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6a4ub_
  • Chain 'C':
    Compound: Ferritin
    Species: Marsupenaeus japonicus [TaxId:27405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B7E1 (0-168)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6a4uc_
  • Chain 'D':
    Compound: Ferritin
    Species: Marsupenaeus japonicus [TaxId:27405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B7E1 (0-168)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6a4ud_
  • Chain 'E':
    Compound: Ferritin
    Species: Marsupenaeus japonicus [TaxId:27405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B7E1 (0-168)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6a4ue_
  • Chain 'F':
    Compound: Ferritin
    Species: Marsupenaeus japonicus [TaxId:27405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B7E1 (0-168)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6a4uf_
  • Heterogens: EDO, SO4, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4uA (A:)
    asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
    haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
    ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4uB (B:)
    asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
    haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
    ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4uC (C:)
    asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
    haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
    ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4uD (D:)
    asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
    haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
    ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4uE (E:)
    asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
    haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
    ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4uF (F:)
    asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
    haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
    ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln