PDB entry 6a4m

View 6a4m on RCSB PDB site
Description: Structure of urate oxidase from Bacillus subtilis 168
Class: hydrolase
Keywords: uricase, Bacillus subtilis, HYDROLASE
Deposited on 2018-06-20, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein PucL
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: pucL, yunL, BSU32450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a4ma1, d6a4ma2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a4mA (A:)
    msygkgnvfayrtylkpltgvkqipessfagrdntvvgvdvtceiggeaflpsftdgdnt
    lvvatdsmknfiqrhlasyegtttegflhyvahrfldtyshmdtitltgedipfeampay
    eekelstsrlvfrrsrnersrsvlkaersgntititeqyseimdlqlvkvsgnsfvgfir
    deyttlpedgnrplfvylniswqyentndsyasdparyvaaeqvrdlastvfheletpsi
    qnliyhigcrilarfpqltdvsfqsqnhtwdtvveeipgskgkvyteprppygfqhftvt
    redae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a4mA (A:)
    msygkgnvfayrtylkpltgvkqipessfagrdntvvgvdvtceigvatdsmknfiqrhl
    asyegtttegflhyvahrfldtyshmdtitltgedipfeampayeekelstsrlvfrrsr
    nersrsvlkaersgntititeqyseimdlqlvkvsgrplfvylniswqyentndsyasdp
    aryvaaeqvrdlastvfheletpsiqnliyhigcrilarfpqltdvsfqsqnhtwdtvve
    eipgskgkvyteprppygfqhftvtreda