PDB entry 6a4h

View 6a4h on RCSB PDB site
Description: Mandelate oxidase mutant-Y128F with the peroxide FMN adduct
Class: flavoprotein
Keywords: FMN-dependent oxidase, FLAVOPROTEIN
Deposited on 2018-06-19, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxymandelate oxidase
    Species: Amycolatopsis orientalis [TaxId:31958]
    Gene: hmo
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52792
      • engineered mutation (147)
    Domains in SCOPe 2.08: d6a4ha_
  • Heterogens: 9QF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a4hA (A:)
    mgsshhhhhhssglvprgshmtyvsladleraardvlpgeifdflaggsgteaslvanrt
    alervfviprmlrdltdvtteidifgrraalpmavapvayqrlfhpegelavaraardag
    vpytictlssvsleeiaavggrpwfqlfwlrdekrsldlvrraedagceaivftvdvpwm
    grrlrdmrngfalpewvtaanfdagtaahrrtqgvsavadhtarefapatwesveavrah
    tdlpvvlkgilavedarravdagaggivvsnhggrqldgavpgiemlgeivaavsggcev
    lvdggirsggdvlkatalgasavlvgrpvmwalaaagqdgvrqllellaeevrdamglag
    cesvgaarrlntklgvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a4hA (A:)
    ladleraardvlpgeifdflaggsgteaslvanrtalervfviprmlrdltdvtteidif
    grraalpmavapvayqrlfhpegelavaraardagvpytictlssvsleeiaavggrpwf
    qlfwlrdekrsldlvrraedagceaivftvdvpwmgrrlrdmrngfalpewvtaanfdfa
    patwesveavrahtdlpvvlkgilavedarravdagaggivvsnhggrqldgavpgieml
    geivaavsggcevlvdggirsggdvlkatalgasavlvgrpvmwalaaagqdgvrqllel
    laeevrdamglagcesvgaarrlntklgv