PDB entry 6a4f

View 6a4f on RCSB PDB site
Description: Separated uridine bound Oligoribonuclease (ORN) from Colwellia psychrerythraea strain 34H
Class: hydrolase
Keywords: Oligoribonuclease, Exonuclease, Colwellia psychrerythraea strain 34H, HYDROLASE
Deposited on 2018-06-19, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligoribonuclease
    Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) [TaxId:167879]
    Gene: orn, CPS_4379
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47VZ4 (2-182)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6a4fa1, d6a4fa2
  • Chain 'B':
    Compound: Oligoribonuclease
    Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) [TaxId:167879]
    Gene: orn, CPS_4379
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47VZ4 (2-182)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6a4fb1, d6a4fb2
  • Heterogens: U5P, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4fA (A:)
    hmmagndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldnm
    npwciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfink
    ympdfedhfhyrnldvstikelakrwkpevlesvvktgahlalddikesiaelkvyrelf
    fkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4fB (B:)
    hmmagndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldnm
    npwciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfink
    ympdfedhfhyrnldvstikelakrwkpevlesvvktgahlalddikesiaelkvyrelf
    fkl