PDB entry 6a4d

View 6a4d on RCSB PDB site
Description: pNP-TMP bound Oligoribonuclease (ORN) from Colwellia psychrerythraea strain 34H
Class: hydrolase
Keywords: Oligoribonuclease, Exonuclease, Colwellia psychrerythraea strain 34H, HYDROLASE
Deposited on 2018-06-19, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligoribonuclease
    Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) [TaxId:167879]
    Gene: orn, CPS_4379
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47VZ4 (3-183)
      • expression tag (0-2)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d6a4da1, d6a4da2
  • Chain 'B':
    Compound: Oligoribonuclease
    Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) [TaxId:167879]
    Gene: orn, CPS_4379
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47VZ4 (3-183)
      • expression tag (2)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d6a4db1, d6a4db2
  • Heterogens: 9RC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4dA (A:)
    gshmagndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldn
    mnpwciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfin
    kympdfedhfhyrnldvstikelakrwkpevlesvvktgahlaldaikesiaelkvyrel
    ffkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a4dB (B:)
    gshmagndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldn
    mnpwciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfin
    kympdfedhfhyrnldvstikelakrwkpevlesvvktgahlaldaikesiaelkvyrel
    ffkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a4dB (B:)
    hmagndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldnmn
    pwciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfinky
    mpdfedhfhyrnldvstikelakrwkpevlesvvktgahlaldaikesiaelkvyrelff
    kl