PDB entry 6a4a

View 6a4a on RCSB PDB site
Description: Oligoribonuclease (ORN) from Colwellia psychrerythraea strain 34H
Class: hydrolase
Keywords: Oligoribonuclease, Exonuclease, Colwellia psychrerythraea strain 34H, HYDROLASE
Deposited on 2018-06-19, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligoribonuclease
    Species: Colwellia psychrerythraea 34H [TaxId:167879]
    Gene: orn, CPS_4379
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6a4aa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a4aA (A:)
    magndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldnmnp
    wciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfinkym
    pdfedhfhyrnldvstikelakrwkpevlesvvktgahlalddikesiaelkvyrelffk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a4aA (A:)
    agndsnliwldlemtglepvedvileiaiiitdselnilaqgpifaisqtddvldnmnpw
    ciehhgksgltqrcrdsevslahatkeslafvqewvpqgkspmcgnsigqdrrfinkymp
    dfedhfhyrnldvstikelakrwkpevlesvvktgahlalddikesiaelkvyrelffkl