PDB entry 6a46

View 6a46 on RCSB PDB site
Description: Structure of TREX2 in complex with a nucleotide (dCMP)
Class: DNA binding protein
Keywords: Exonuclease, DEDDh exonuclease, DNA BINDING PROTEIN
Deposited on 2018-06-19, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 2
    Species: Mus musculus [TaxId:10090]
    Gene: TREX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a46a_
  • Chain 'B':
    Compound: Three prime repair exonuclease 2
    Species: Mus musculus [TaxId:10090]
    Gene: TREX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a46b_
  • Heterogens: MG, DCM, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a46A (A:)
    mgsshhhhhhssglvprgshmseppraetfvfldleatglpnmdpeiaeislfavhrssl
    enperddsgslvlprvldkltlcmcperpftakaseitglsseslmhcgkagfngavvrt
    lqgflsrqegpiclvahngfdydfpllctelqrlgahlpqdtvcldtlpalrgldrahsh
    gtraqgrksyslaslfhryfqaepsaahsaegdvhtllliflhrapellawadeqarswa
    hiepmyvppdgpslea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a46A (A:)
    eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltl
    cmcperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdy
    dfpllctelqrlgahlpqdtvcldtlpalrgldrahsrksyslaslfhryfqaepsaahs
    aegdvhtllliflhrapellawadeqarswahiepmyvppdgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a46B (B:)
    mgsshhhhhhssglvprgshmseppraetfvfldleatglpnmdpeiaeislfavhrssl
    enperddsgslvlprvldkltlcmcperpftakaseitglsseslmhcgkagfngavvrt
    lqgflsrqegpiclvahngfdydfpllctelqrlgahlpqdtvcldtlpalrgldrahsh
    gtraqgrksyslaslfhryfqaepsaahsaegdvhtllliflhrapellawadeqarswa
    hiepmyvppdgpslea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a46B (B:)
    eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddslvlprvldkltlcm
    cperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdydf
    pllctelqrlgahlpqdtvcldtlpalrgldrahrksyslaslfhryfqaepsaahsaeg
    dvhtllliflhrapellawadeqarswahiepm