PDB entry 6a45

View 6a45 on RCSB PDB site
Description: Structure of mouse TREX2
Class: DNA binding protein
Keywords: Exonuclease, DEDDh exonuclease, DNA BINDING PROTEIN
Deposited on 2018-06-19, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 2
    Species: Mus musculus [TaxId:10090]
    Gene: TREX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a45a_
  • Chain 'B':
    Compound: Three prime repair exonuclease 2
    Species: Mus musculus [TaxId:10090]
    Gene: TREX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a45b_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a45A (A:)
    mgsshhhhhhssglvprgshmseppraetfvfldleatglpnmdpeiaeislfavhrssl
    enperddsgslvlprvldkltlcmcperpftakaseitglsseslmhcgkagfngavvrt
    lqgflsrqegpiclvahngfdydfpllctelqrlgahlpqdtvcldtlpalrgldrahsh
    gtraqgrksyslaslfhryfqaepsaahsaegdvhtllliflhrapellawadeqarswa
    hiepmyvppdgpslea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a45A (A:)
    eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltl
    cmcperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdy
    dfpllctelqrlgahlpqdtvcldtlpalrgldrahsgrksyslaslfhryfqaepsaah
    saegdvhtllliflhrapellawadeqarswahiepmyvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a45B (B:)
    mgsshhhhhhssglvprgshmseppraetfvfldleatglpnmdpeiaeislfavhrssl
    enperddsgslvlprvldkltlcmcperpftakaseitglsseslmhcgkagfngavvrt
    lqgflsrqegpiclvahngfdydfpllctelqrlgahlpqdtvcldtlpalrgldrahsh
    gtraqgrksyslaslfhryfqaepsaahsaegdvhtllliflhrapellawadeqarswa
    hiepmyvppdgpslea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a45B (B:)
    praetfvfldleatglpnmdpeiaeislfavhrsslenperdgslvlprvldkltlcmcp
    erpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdydfpl
    lctelqrlgahlpqdtvcldtlpalrgldrahksyslaslfhryfqaepsaahsaegdvh
    tllliflhrapellawadeqarswahiepmy