PDB entry 6a3n

View 6a3n on RCSB PDB site
Description: Crystal structure of the PDE9 catalytic domain in complex with inhibitor 2
Class: hydrolase
Keywords: PDE9 inhibitor complex, HYDROLASE
Deposited on 2018-06-15, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE9A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a3na_
  • Chain 'B':
    Compound: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE9A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a3nb_
  • Heterogens: 9Q9, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3nA (A:)
    kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
    nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
    inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
    marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
    fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
    esrdryeelkriddamkelqkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3nB (B:)
    kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
    nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
    inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
    marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
    fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
    esrdryeelkriddamkelqkk