PDB entry 6a3l

View 6a3l on RCSB PDB site
Description: Crystal structure of cytochrome c' from Shewanella violacea DSS12
Class: electron transport
Keywords: Cytochrome c', Shewanella, ELECTRON TRANSPORT
Deposited on 2018-06-15, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) [TaxId:637905]
    Gene: SVI_0970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a3la_
  • Chain 'B':
    Compound: cytochrome c
    Species: Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) [TaxId:637905]
    Gene: SVI_0970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a3lb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3lA (A:)
    gnfkeaddaihyrqsafslmahnfgdmgamlkgkkpfdseiftmraenvaalsklplegf
    iqgsdlgdtealakiwtdksdfdakmvslqdnaaalllasasddkkllkqsfmkvaksck
    gchdvykkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3lB (B:)
    gnfkeaddaihyrqsafslmahnfgdmgamlkgkkpfdseiftmraenvaalsklplegf
    iqgsdlgdtealakiwtdksdfdakmvslqdnaaalllasasddkkllkqsfmkvaksck
    gchdvykkd