PDB entry 6a3k

View 6a3k on RCSB PDB site
Description: Crystal structure of cytochrome c' from Shewanella benthica DB6705
Class: electron transport
Keywords: Cytochrome c', Shewanella, ELECTRON TRANSPORT
Deposited on 2018-06-15, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Shewanella benthica DB6705 [TaxId:126830]
  Database cross-references and differences (RAF-indexed):
  • PDB 6A3K (0-128)
  Domains in SCOPe 2.08: d6a3ka_
• Heterogens: HEC, 1PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6a3kA (A:)
  snfkeaddaihyrqsafslmahnfgdmgamlkgkkpfdseifamraqnvaalsklplegf
  ipgsdqgetealakiwteksdfdakmktlqdnaaalllasasddkkllkqsfmqvaksck
  gchdvykkd