PDB entry 6a3e

View 6a3e on RCSB PDB site
Description: MVM NES mutant Nm15 in complex with CRM1-Ran-RanBP1
Class: transport protein
Keywords: transport protein, nuclear export, complex, mutant, inhibitor
Deposited on 2018-06-15, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (Start-234)
      • engineered mutation (215)
    Domains in SCOPe 2.07: d6a3ea_
  • Chain 'B':
    Compound: Ran-specific GTPase-activating protein 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YRB1, CST20, HTN1, SFO1, YDR002W, YD8119.08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a3eb_
  • Chain 'C':
    Compound: Exportin-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CRM1, KAP124, XPO1, YGR218W, G8514
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30822 (3-End)
      • expression tag (1-2)
      • engineered mutation (481)
      • engineered mutation (483-485)
      • engineered mutation (966)
  • Chain 'D':
    Compound: MVM NES mutant Nm15
    Species: Minute virus of mice [TaxId:10794]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3E
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a3eA (A:)
    gsshhhhhhssglvprgshmaaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyva
    tlgvevhplvfhtnrgpikfnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknv
    pnwhrdlvrvcenipivlcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpf
    lwlarkligdpnlefvampalappevvmdpalaaqaehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a3eA (A:)
    pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
    agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
    kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
    vvmdpalaaqaehdlevaqttalpdedddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a3eB (B:)
    ggsdihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkk
    tnkvrilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairf
    gskenadkfkeefekaqeinkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a3eB (B:)
    hfepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktl
    kicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefe
    kaqeinkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.