PDB entry 6a2t

View 6a2t on RCSB PDB site
Description: Mycobacterium tuberculosis LexA C-domain K197A
Class: hydrolase
Keywords: Mycobacterium tuberculosis, LexA, SOS response, HYDROLASE
Deposited on 2018-06-12, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d6a2ta_
  • Heterogens: AKR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a2tA (A:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvatfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2tA (A:)
    relvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvatfkra
    ggqvwlmphnpafdpipgndatvlgkvvtvirkv